SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000420318 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000420318
Domain Number 1 Region: 7-206
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.27e-52
Family DBL homology domain (DH-domain) 0.0000147
Further Details:      
 
Domain Number 2 Region: 207-324
Classification Level Classification E-value
Superfamily PH domain-like 3.23e-32
Family Pleckstrin-homology domain (PH domain) 0.00062
Further Details:      
 
Domain Number 3 Region: 413-476
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000083
Family SH3-domain 0.0000302
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000420318   Gene: ENSG00000160145   Transcript: ENST00000459915
Sequence length 489
Comment pep:putative chromosome:GRCh38:3:124637097:124674958:1 gene:ENSG00000160145 transcript:ENST00000459915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPTPPKNPEEEQKAKALRGRMFVLNELVQTEKDYVKDLGIVVEGFMKRIEEKGVPEDM
RGKDKIVFGNIHQIYDWHKDFFLAELEKCIQEQDRLAQLFIKHERKLHIYVWYCQNKPRS
EYIVAEYDAYFEEVKQEINQRLTLSDFLIKPIQRITKYQLLLKDFLRYSEKAGLECSDIE
KAVELMCLVPKRCNDMMNLGRLQGFEGTLTAQGKLLQQDTFYVIELDAGMQSRTKERRVF
LFEQIVIFSELLRKGSLTPGYMFKRSIKMNYLVLEENVDNDPCKFALMNRETSERVVLQA
ANADIQQAWVQDINQVLETQRDFLNALQSPIEYQRKERSTAVMRSQPARLPQASPRPYSS
VPAGSEKPPKGSSYNPPLPPLKISTSNGSPGFEYHQPGDKFEASKNDLGGCNGTSSMAVI
KDYYALKENEICVSQGEVVQVLAVNQQNMCLVYQPASDHSPAAEGWVPGSILAPLTKATA
AESSDGSIK
Download sequence
Identical sequences ENSP00000420318 ENSP00000420318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]