SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000420402 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000420402
Domain Number 1 Region: 120-195
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.2e-16
Family DBL homology domain (DH-domain) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000420402   Gene: ENSG00000163947   Transcript: ENST00000473779
Sequence length 196
Comment pep:putative chromosome:GRCh38:3:56751300:56977375:-1 gene:ENSG00000163947 transcript:ENST00000473779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFDRNIWPKRQRQNNFPMFPSPKAWNFRGRKRKQSTQDEDAVSLCSLDISEPSNKRVKPL
SRVTSLANLIPPVKATPLKRFSQTLQRSISFRSESRPDILAPRPWSRNAAPSSTKRRDSK
LWSETFDVCVNQMLTSKEIKRQEAIFELSQGEEDLIEDLKLAKKAYHDPMLKLSIMTEQE
LNQIFGTLDSLIPLHE
Download sequence
Identical sequences A0A2J8P7V7 C9JNF2
ENSP00000420402 ENSP00000420402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]