SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000420420 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000420420
Domain Number 1 Region: 110-319
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-54
Family DBL homology domain (DH-domain) 0.0000597
Further Details:      
 
Domain Number 2 Region: 330-453
Classification Level Classification E-value
Superfamily PH domain-like 1.59e-19
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000420420   Gene: ENSG00000163947   Transcript: ENST00000496106
Sequence length 532
Comment pep:novel chromosome:GRCh38:3:56728987:56916471:-1 gene:ENSG00000163947 transcript:ENST00000496106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSERPMVWCCLFVRSQRKRKQSTQDEDAVSLCSLDISEPSNKRVKPLSRVTSLANLIPP
VKATPLKRFSQTLQRSISFRSESRPDILAPRPWSRNAAPSSTKRRDSKLWSETFDVCVNQ
MLTSKEIKRQEAIFELSQGEEDLIEDLKLAKKAYHDPMLKLSIMTEQELNQIFGTLDSLI
PLHEELLSQLRDVRKPDGSTEHVGPILVGWLPCLSSYDSYCSNQVAAKALLDHKKQDHRV
QDFLQRCLESPFSRKLDLWNFLDIPRSRLVKYPLLLREILRHTPNDNPDQQHLEEAINII
QGIVAEINTKTGESECRYYKERLLYLEEGQKDSLIDSSRVLCCHGELKNNRGVKLHVFLF
QEVLVITRAVTHNEQLCYQLYRQPIPVKDLLLEDLQDGEVRLGGSLRGAFSNNERIKNFF
RVSFKNGSQSQTHSLQANDTFNKQQWLNCIRQAKETVLCAAGQAGVLDSEGSFLNPTTGS
RELQGETKLEQMDQSDSESDCSMDTSEVSLDCERMEQTDSSCGNSRHGESNV
Download sequence
Identical sequences A0A2I2ZTX9 A0A2I3TCV0 E9PG37
ENSP00000420420 NP_001276627.1.87134 NP_001276627.1.92137 XP_003818763.1.60992 XP_004034391.1.27298 XP_516548.3.37143 ENSP00000420420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]