SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000420447 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000420447
Domain Number 1 Region: 2-81
Classification Level Classification E-value
Superfamily Immunoglobulin 2.24e-16
Family V set domains (antibody variable domain-like) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000420447   Gene: ENSG00000112763   Transcript: ENST00000493173
Sequence length 86
Comment pep:putative chromosome:GRCh38:6:26457950:26463253:1 gene:ENSG00000112763 transcript:ENST00000493173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRTTFVSKDISRGSVALVIHNITAQENG
TYRCYFQEGRSYDEAILHLVVAGLGS
Download sequence
Identical sequences A0A2J8JQN3
ENSP00000420447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]