SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000420490 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000420490
Domain Number 1 Region: 33-168
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 9.19e-17
Family 4HBT-like 0.0097
Further Details:      
 
Domain Number 2 Region: 211-263
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 0.0000000388
Family 4HBT-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000420490   Gene: ENSG00000123130   Transcript: ENST00000473710
Sequence length 264
Comment pep:novel chromosome:GRCh38:X:23705058:23733197:-1 gene:ENSG00000123130 transcript:ENST00000473710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVGASTNWRDHVKAMEERKLLHSFLAKSQDGLPPRRMKDSYIEVLLPLGSEPELREKYLT
VQNTVRFGRILEDLDSLGDMCKKSLSPEQDIKFSGHVSWVGKTSMEVKMQMFQLHGDEFC
PVLDATFVMVARDSENKGPAFVNPLIPESPEEEELFRQGELNKGRRIAFSSTSLLKMAPS
AEERTTIHEMFLSTLDPKTISFRSRVLPSNAVWMENSKLKSLEICHPQERNIFNRIFGGF
LMRKAYELAWATACSFGGSRPFVV
Download sequence
Identical sequences H7C5Q2
ENSP00000420490 ENSP00000420490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]