SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000420746 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000420746
Domain Number 1 Region: 8-174
Classification Level Classification E-value
Superfamily PP2C-like 6.41e-53
Family PP2C-like 0.0000558
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000420746   Gene: ENSG00000163590   Transcript: ENST00000464260
Sequence length 181
Comment pep:putative chromosome:GRCh38:3:160842213:161071028:1 gene:ENSG00000163590 transcript:ENST00000464260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEKLTVSYDEAGTTCLIALLSDKDLTVANVGDSRGVLCDKDGNAIPLSHDHKPYQLKER
KRIKRAGGFISFNGSWRVQGILAMSRSLGDYPLKNLNVVIPDPDILTFDLDKLQPEFMIL
ASDGLWDAFSNEEAVRFIKERLDEPHFGAKSIVLQSFYRGCPDNITVMVVKFRNSSKTEE
Q
Download sequence
Identical sequences A0A2J8P1X0 A0A2J8WTP8 G3HHC1 L5KYI6
NP_001304841.1.87134 NP_001304841.1.92137 XP_015300750.1.63531 XP_017392798.1.71028 XP_019296015.1.44245 XP_019296016.1.44245 XP_019482422.1.44202 XP_019482428.1.44202 XP_019666051.1.62641 XP_021525198.1.9421 ENSP00000420746 ENSP00000420746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]