SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000420754 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000420754
Domain Number 1 Region: 14-204
Classification Level Classification E-value
Superfamily PRTase-like 5.68e-44
Family Phosphoribosyltransferases (PRTases) 0.0005
Further Details:      
 
Domain Number 2 Region: 234-326
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.69e-22
Family Decarboxylase 0.0000729
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000420754   Gene: ENSG00000114491   Transcript: ENST00000479719
Sequence length 342
Comment pep:known chromosome:GRCh38:3:124730452:124744757:1 gene:ENSG00000114491 transcript:ENST00000479719 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAVARAALGPLVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADILFQT
AQNAGISFDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGTINPGETCL
IIEDVVTSGSSVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKML
EILEQQKKVDAETVGRVKRFIQENVFVAANHNGSPLSIKEAPKELSFGARAELPRIHPVA
SKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELIT
LAKCHEFLIFEDRKFADIGNTVKKQYEGKCIIQESARIRNPA
Download sequence
Identical sequences E9PFD2
ENSP00000420754 ENSP00000420754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]