SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000420786 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000420786
Domain Number - Region: 18-50
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.0246
Family Glutamine synthetase, N-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000420786   Gene: ENSG00000114127   Transcript: ENST00000486211
Sequence length 107
Comment pep:known chromosome:GRCh38:3:142418419:142448012:-1 gene:ENSG00000114127 transcript:ENST00000486211 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MGVPKFYRWISERYPCLSEVVKEHQIPEFDNLYLDMNGIIHQCSHPNDDDVHFRISDDKI
FTDIFHYLEVLFRIIKPRKVFFMAVDGVAPRAKMNQQRGRRFRLCLD
Download sequence
Identical sequences A0A2J8TT82 F8WDA0
ENSP00000420786 ENSP00000420786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]