SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000420871 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000420871
Domain Number 1 Region: 60-103
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 0.00000000000000366
Family Substrate-binding domain of HMG-CoA reductase 0.0006
Further Details:      
 
Domain Number 2 Region: 2-30
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 0.00000000366
Family NAD-binding domain of HMG-CoA reductase 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000420871   Gene: ENSG00000113161   Transcript: ENST00000511986
Sequence length 115
Comment pep:putative chromosome:GRCh38:5:75358690:75360481:1 gene:ENSG00000113161 transcript:ENST00000511986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVIPAKVVREMLGVQGACKDNPGE
NARQLARIVCGTVMAGELSLMAALAAGHLVKSHMIHNRSKINLQDLQGACTKKTA
Download sequence
Identical sequences A0A2J8VTB1 F7HJ10 H0Y8F6
ENSP00000420871 ENSP00000420871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]