SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000421105 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000421105
Domain Number 1 Region: 65-110
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 0.00000000000916
Family GatB/GatE catalytic domain-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000421105   Gene: ENSG00000059691   Transcript: ENST00000508611
Sequence length 115
Comment pep:putative chromosome:GRCh38:4:151721946:151760990:-1 gene:ENSG00000059691 transcript:ENST00000508611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPMLRWGCRGRRWAFARVDGGSCHRRGAPTGSTSNQIRGESSVAQQPLHTAQKTRKGE
HKWAAVVGLEIHAQISSNSKLFSGSQVRFSAPPNSLVSFFDASLPGTLPSEDSPS
Download sequence
Identical sequences D6RGY4
ENSP00000421105 ENSP00000421105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]