SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000421474 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000421474
Domain Number - Region: 71-95
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 0.0277
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000421474   Gene: ENSG00000242441   Transcript: ENST00000508440
Sequence length 102
Comment pep:putative chromosome:GRCh38:2:48669797:48733148:1 gene:ENSG00000242441 transcript:ENST00000508440 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGDTSSNEEIGSTRDADENEFLGNIDGGDLKVPEEEADSISNEDSATNSSDNEDPQVNIV
EEDPLNSGDDVSEQDVPDLFDTDNVIVCQYDKAFPRRTSFNT
Download sequence
Identical sequences H0Y8M0
ENSP00000421474 ENSP00000421474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]