SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000421599 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000421599
Domain Number 1 Region: 31-151
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000000823
Family Armadillo repeat 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000421599   Gene: ENSG00000138698   Transcript: ENST00000511212
Sequence length 158
Comment pep:novel chromosome:GRCh38:4:98261486:98392041:1 gene:ENSG00000138698 transcript:ENST00000511212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADNLSDTLKKLKITAVDKTEDSLEGCLDCLLQALAQNNTETSEKIQASGILQLFASLLT
PQSSCKAKVANIIAEVAKNDEGRSAVDQAGGAQIVIDHLRSLCSITDPANEKLLTVFCGM
LMNYSNENDSLQAQLINMGVIPTLVKLLGIHCQNAALT
Download sequence
Identical sequences A0A2J8TQU6 D6REZ0
ENSP00000421599 ENSP00000421599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]