SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000422861 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000422861
Domain Number 1 Region: 35-116
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000564
Family Heme-binding PAS domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000422861   Gene: ENSG00000113231   Transcript: ENST00000503963
Sequence length 119
Comment pep:putative chromosome:GRCh38:5:77325693:77351118:1 gene:ENSG00000113231 transcript:ENST00000503963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENSSIIACYNELIQIEHGEVRSQFKLRACNSVFTALDHCHEAIEITSDDHVIQYVNPAF
ERMMGYHKGELLGKELADLPKSDKNRADLLDTINTCIKKGKEWQGVYYARRKSGDSIQQ
Download sequence
Identical sequences A0A2J8NNA1 A0A2J8VT61 D6R9W0
ENSP00000422861 ENSP00000422861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]