SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000423129 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000423129
Domain Number 1 Region: 383-956
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 7.85e-141
Family alpha-mannosidase, C-terminal domain 0.0000482
Further Details:      
 
Domain Number 2 Region: 25-300
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 5.34e-80
Family alpha-mannosidase 0.0000261
Further Details:      
 
Domain Number 3 Region: 305-405
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 1.86e-27
Family alpha-mannosidase, domain 2 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000423129   Gene: ENSG00000013288   Transcript: ENST00000504248
Sequence length 958
Comment pep:novel chromosome:GRCh38:4:6575189:6621354:1 gene:ENSG00000013288 transcript:ENST00000504248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQLCWLPLLAPLLLLRPPGVQSAGPIRAFVVPHSHMDVGWVYTVQESMRAYAANVYTSV
VEELARGQQRRFIAVEQEFFRLWWDGVASDQQKYQVRQLLEEGRLEFVIGGQVMHDEAVT
HLDDQILQLTEGHGFLYETFGIRPQFSWHVDPFGASATTPTLFALAGFNAHLGSRIDYDL
KAAMQEARGLQFVWRGSPSLSERQEIFTHIMDQYSYCTPSHIPFSNRSGFYWNGVAVFPK
PPQDGVYPNMSEPVTPANINLYAELGVSVQYATLGDYFRALHALNVTWRVRDHHDFLPYS
TEPFQAWTGFYTSRSSLKGLARRASALLYAGESMFTRYLWPAPRGHLDPTWALQQLQQLR
WAVSEVQHHDAITGTESPKVRDMYATHLASGMLGMRKLMASIVLDELQPQAPMAASSDAG
PAGHFASVYNPLAWTVTTIVTLTVGFPGVRVTDEAGHPVPSQIQNSTETPSAYDLLILTT
IPGLSYRHYNIRPTAGAQEGTQEPAATVASTLQFGRRLRRRTSHAGRYLVPVANDCYIVL
LDQDTNLMHSIWERQSNRTVRVTQEFLEYHVNGDVKQGPISDNYLFTPGKAAVPAWEAVE
MEIVAGQLVTEIRQYFYRNMTAQNYTYAIRSRLTHVPQGHDGELLCHRIEQEYQAGPLEL
NREAVLRTSTNLNSQQVIYSDNNGYQMQRRPYVSYVNNSIARNYYPMVQSAFMEDGKSRL
VLLSERAHGISSQGNGQVEVMLHRRLWNNFDWDLGYNLTLNDTSVVHPVLWLLLGSWSLT
TALRQRSALALQHRPVVLFGDLAGTAPKLPGPQQQEAVTLPPNLHLQILSIPGWRYSSNH
TEHSQNLRKGHRGEAQADLRRVLLRLYHLYEVGEDPVLSQPVTVNLEAVLQALGSVVAVE
ERSLTGTWDLSMLHRWSWRTGPGRHRGDTTSPSRPPGGPIITVHPKEIRTFFIHFQQQ
Download sequence
Identical sequences E9PCD7
ENSP00000423129 ENSP00000423129 NP_001278967.1.87134 NP_001278967.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]