SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000423229 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000423229
Domain Number 1 Region: 3-125
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.93e-23
Family Phosphate binding protein-like 0.000000466
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000423229   Gene: ENSG00000120251   Transcript: ENST00000510854
Sequence length 214
Comment pep:putative chromosome:GRCh38:4:157341429:157363164:1 gene:ENSG00000120251 transcript:ENST00000510854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTM
NEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLRTPVNLAVLKLSEQGVLDKLKNKWWY
DKGECGAKDSGSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMKVA
KNAQNINPSSSQNSQNFATYKEGYNVYGIESVKI
Download sequence
Identical sequences H0Y972
ENSP00000423229 ENSP00000423229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]