SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000423323 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000423323
Domain Number 1 Region: 14-91
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000000112
Family Multidrug resistance efflux transporter EmrE 0.015
Further Details:      
 
Weak hits

Sequence:  ENSP00000423323
Domain Number - Region: 148-226
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0798
Family Multidrug resistance efflux transporter EmrE 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000423323   Gene: ENSG00000121073   Transcript: ENST00000503334
Sequence length 227
Comment pep:putative chromosome:GRCh38:17:49702892:49708163:-1 gene:ENSG00000121073 transcript:ENST00000503334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCDQCCVCQDLVDRTRSWLYAACSISYLGAMVSSNSALQFVNYPTQVLGKSCKPIPVMLL
GVTLLKKKYPLAKYLCVLLIVAGVALFMYKPKKVVGIEEHTVGYGELLLLLSLTLDGLTG
VSQDHMRAHYQTGSNHMMLNINLWSTLLLGMGILFTGELWEFLSFAERYPAIIYNILLFG
LTSALGQSFIFMTVVYFGPLTCSIITTTRKFFTILASVILFANPISP
Download sequence
Identical sequences A0A2J8W902 D6R981
ENSP00000423323 ENSP00000423323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]