SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000423889 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000423889
Domain Number 1 Region: 32-226
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 5.49e-76
Family Inorganic pyrophosphatase 0.00000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000423889   Gene: ENSG00000138777   Transcript: ENST00000508518
Sequence length 226
Comment pep:novel chromosome:GRCh38:4:105399079:105474040:-1 gene:ENSG00000138777 transcript:ENST00000508518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XLRLLRTGAPAAACLRLGTSAGTGSRRAMALYHTEERGQPCSQNYRLFFKNVTGHYISPF
HDIPLKVNSKEENGIPMKKARNDEYEIATKEPMNPIKQYVKDGKLRYVANIFPYKGYIWN
YGTLPQTWEDPHEKDKSTNCFGDNDPIDVCEIGSKILSCGEVIHVKILGILALIDEGETD
WKLIAINANDPEASKFHDIDDVKKFKPGYLEATLNWFRLYKVPDGK
Download sequence
Identical sequences H0Y9D8
ENSP00000423889 ENSP00000423889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]