SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000424463 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000424463
Domain Number 1 Region: 10-68
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.78e-19
Family APC10-like 0.0000679
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000424463   Gene: ENSG00000164162   Transcript: ENST00000502847
Sequence length 68
Comment pep:known chromosome:GRCh38:4:145081660:145098135:-1 gene:ENSG00000164162 transcript:ENST00000502847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQ
PHLVNIQF
Download sequence
Identical sequences A0A2J8MU90 A0A2J8XNV7 D6RB36
ENSP00000424463 ENSP00000424463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]