SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000425190 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000425190
Domain Number 1 Region: 33-186,241-294
Classification Level Classification E-value
Superfamily TPR-like 1.21e-18
Family Tetratricopeptide repeat (TPR) 0.027
Further Details:      
 
Weak hits

Sequence:  ENSP00000425190
Domain Number - Region: 192-258
Classification Level Classification E-value
Superfamily LemA-like 0.0575
Family LemA-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000425190   Gene: ENSG00000174780   Transcript: ENST00000505314
Sequence length 357
Comment pep:putative chromosome:GRCh38:4:56474134:56491565:1 gene:ENSG00000174780 transcript:ENST00000505314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XERKTNLSAVVAAQSNWEKVVPENLGLQEGTHELCYNTACALIGQGQLNQAMKILQKAED
LCRRSLSEDTDGTEEDPQAELAIIHGQMAYILQLQGRTEEALQLYNQIIKLKPTDVGLLA
VIANNIITINKAEQCRKISASLQSQSPEHLLPVLIQAAQLCREKQHTKAIELLQEFSDQH
PENAAEIKLTMAQLKISQGNISKACLILRSIEELKHKPGMVSALVTMYSHEEDIDSAIEV
FTQAIQWYQNHQPKSPAHLSLIREAANFKLKYGRKKEAISDLQQLWKQNPKDIHTLAQLI
SAYSLVDPEKAKALSKHLPSSDSMSLKVDVEALENSAGATYIRKKGGKVTGDSQPKE
Download sequence
Identical sequences D6RDY6
ENSP00000425190 ENSP00000425190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]