SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000425621 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000425621
Domain Number 1 Region: 10-98
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.32e-17
Family DBL homology domain (DH-domain) 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000425621   Gene: ENSG00000183111   Transcript: ENST00000505810
Sequence length 103
Comment pep:known chromosome:GRCh38:5:149551947:149601231:1 gene:ENSG00000183111 transcript:ENST00000505810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKHGADEPSSRSGSPDREGRASEDRSLLHQRLAVRELIDTEVSYLHMLQLCASDIRSRL
QQLPQGDLDVLFSNIDDIIKVNSRFLHDLQETASKEEEQVQLV
Download sequence
Identical sequences D6RJH4
ENSP00000425621 ENSP00000425621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]