SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000425640 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000425640
Domain Number 1 Region: 10-94
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 3.66e-20
Family Acetyl-CoA synthetase-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000425640   Gene: ENSG00000151726   Transcript: ENST00000505492
Sequence length 94
Comment pep:putative chromosome:GRCh38:4:184768328:184773873:-1 gene:ENSG00000151726 transcript:ENST00000505492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XLGRANRRKPKPPAPEDLAVICFTSGTTGNPKGAMVTHRNIVSDCSAFVKATECVMLCHG
AKIGFFQGDIRLLMDDLKVLQPTVFPVVPRLLNR
Download sequence
Identical sequences H0Y9Z9
ENSP00000425640 ENSP00000425640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]