SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000425671 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000425671
Domain Number 1 Region: 2-53
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.00000000000217
Family Tyrosine-dependent oxidoreductases 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000425671   Gene: ENSG00000145439   Transcript: ENST00000507752
Sequence length 60
Comment pep:known chromosome:GRCh38:4:169007641:169010275:-1 gene:ENSG00000145439 transcript:ENST00000507752 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MDKVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLEGAKAAAGDLGGLPIMLPVLDPNS
Download sequence
Identical sequences D6RJF4
ENSP00000425671 ENSP00000425671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]