SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000425983 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000425983
Domain Number 1 Region: 6-48
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000000117
Family Protein kinases, catalytic subunit 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000425983   Gene: ENSG00000134058   Transcript: ENST00000506789
Sequence length 58
Comment pep:known chromosome:GRCh38:5:69234892:69262207:1 gene:ENSG00000134058 transcript:ENST00000506789 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGYNKG
Download sequence
Identical sequences A0A2J8L104 A0A2J8VTT5 D6RI01
ENSP00000425983 ENSP00000461338 ENSP00000425983 ENSP00000477752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]