SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000426283 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000426283
Domain Number 1 Region: 14-78
Classification Level Classification E-value
Superfamily Histone-fold 2.29e-20
Family TBP-associated factors, TAFs 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000426283   Gene: ENSG00000273841   Transcript: ENST00000504109
Sequence length 136
Comment pep:known chromosome:GRCh38:5:69365331:69367909:-1 gene:ENSG00000273841 transcript:ENST00000504109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESGKTASPKSMPKDAQMMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSH
AKKATVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQRNQTPLPLIKPYSGPRLPPDRY
CLTAPNYRLKSLQKKA
Download sequence
Identical sequences ENSP00000426283 ENSP00000482215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]