SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000426416 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000426416
Domain Number 1 Region: 2-39
Classification Level Classification E-value
Superfamily ISY1 domain-like 7.32e-16
Family ISY1 N-terminal domain-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000426416   Gene: ENSG00000240682   Transcript: ENST00000496163
Sequence length 148
Comment pep:putative chromosome:GRCh38:3:129129879:129145874:-1 gene:ENSG00000240682 transcript:ENST00000496163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGLGEFRIRDLNDEINKLLREKGHWEVRIKELGGPDYGKVGPKMLDHEGKEVPGNRGYKY
FGAAKDLPGVRELFEKEPLPPPRKTRAELMKAIDFEYYGYLDEDDGVIVPLEQEYEKKLG
RGRQPGERRGRQPAEVHCSRPCSLAARD
Download sequence
Identical sequences H0YA89
ENSP00000426416 ENSP00000426416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]