SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000426725 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000426725
Domain Number 1 Region: 42-382
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.41e-48
Family Quinoprotein alcohol dehydrogenase-like 0.018
Further Details:      
 
Domain Number 2 Region: 344-464
Classification Level Classification E-value
Superfamily TolB, C-terminal domain 1.83e-20
Family TolB, C-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000426725   Gene: ENSG00000071127   Transcript: ENST00000502702
Sequence length 466
Comment pep:known chromosome:GRCh38:4:10075149:10116727:-1 gene:ENSG00000071127 transcript:ENST00000502702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPYEIKKVFASLPQVERGVSKIIGGDPKGNNFLYTNGKCVILRNIDDHSRFVNCVRFSPD
GNRFATASADGQIYIYDGKTGEKVCALGGSKAHDGGIYAISWSPDSTHLLSASGDKTSKI
WDVSVNSVVSTFPMGSTVLDQQLGCLWQKDHLLSVSLSGYINYLDRNNPSKPLHVIKGHS
KSIQCLTVHKNGGKSYIYSGSHDGHINYWDSETGENDSFAGKGHTNQVSRMTVDESGQLI
SCSMDDTVRYTSLMLRDYSGQGVVKLDVQPKCVAVGPGGYAVVVCIGQIVLLKDQRKCFS
IDNPGYEPEVVAVHPGGDTVAIGGVDGNVRLYSILGTTLKDEGKLLEAKGPVTDVAYSHD
GAFLAVCDASKVVTVFSVADGYSENNVFYGHHAKIVCLAWSPDNEHFASGGMDMMVYVWT
LSDPETRVKIQDAHRLHHVSSLAWLDEHTLVTTSHDASVKEWTITY
Download sequence
Identical sequences ENSP00000371889 ENSP00000426725 gi|53729352|ref|NP_005103.2| ENSP00000371889 ENSP00000426725 NP_005103.2.87134 NP_005103.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]