SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000427852 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000427852
Domain Number 1 Region: 5-148
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.96e-53
Family Carbonic anhydrase 0.0000000496
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000427852   Gene: ENSG00000133742   Transcript: ENST00000522579
Sequence length 149
Comment pep:known chromosome:GRCh38:8:85333528:85378113:-1 gene:ENSG00000133742 transcript:ENST00000522579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEI
INVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELH
VAHWNSAKYSSLAEAASKADGLAVIGVLM
Download sequence
Identical sequences E5RG43
ENSP00000427852 ENSP00000430471 ENSP00000427852 ENSP00000430471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]