SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000427895 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000427895
Domain Number 1 Region: 7-53
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000131
Family F-box domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000427895   Gene: ENSG00000135722   Transcript: ENST00000521920
Sequence length 62
Comment pep:putative chromosome:GRCh38:16:67160005:67162954:1 gene:ENSG00000135722 transcript:ENST00000521920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPGEGLPEEVLALIFRHLSLRDRAAAARVCRAWAAAATCSAVWHDTKIRFHPVADATE
IF
Download sequence
Identical sequences A0A2I2ZUZ8 A0A2I3T8S4 A0A2J8VUK2 E5RFX2
ENSP00000427895 ENSP00000427895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]