SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000427920 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000427920
Domain Number 1 Region: 327-441,561-707
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.61e-63
Family Phosphate binding protein-like 0.00000000208
Further Details:      
 
Domain Number 2 Region: 73-305
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.7e-34
Family L-arabinose binding protein-like 0.014
Further Details:      
 
Domain Number 3 Region: 457-560
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000188
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000427920   Gene: ENSG00000155511   Transcript: ENST00000518142
Sequence length 826
Comment pep:putative chromosome:GRCh38:5:153490655:153811271:1 gene:ENSG00000155511 transcript:ENST00000518142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQHIFAFFCTGFLGAVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQID
IVNISDSFEMTYRCLSVLQKVLDTAAEKNWQVTAVNILTTTEEGYRMLFQDLEKKKERLV
VVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTD
TIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVMAEAFQSLRRQRIDISRRGNA
GDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIG
YWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGNDRYEGYCV
ELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVRE
EVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRF
SPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWW
FFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAV
FEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGN
LDSKGYGIATPKGSALRNPVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSA
LSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMKGFCLIPQQSINEAIRTSTLP
RNSGAGASSGGSGENGRVVSHDFPKSMQSIPCMSHSSGMPLGATGL
Download sequence
Identical sequences A0A1D5QCP7 A0A2I3SP74 A0A2K5HA39 A0A2K5N2E9 A0A2K5VFE5 A0A2K5ZIE1
ENSP00000427920 ENSP00000427920 NP_001244948.1.87134 NP_001244948.1.92137 XP_011787031.1.43180 XP_011836626.1.47321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]