SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000428055 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000428055
Domain Number 1 Region: 3-87
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 5.76e-22
Family Iron-containing alcohol dehydrogenase 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000428055   Gene: ENSG00000147576   Transcript: ENST00000523113
Sequence length 88
Comment pep:putative chromosome:GRCh38:8:66430185:66445324:1 gene:ENSG00000147576 transcript:ENST00000523113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLKNMGAKNVCLMTDKNLSKLPPVQVAMDSLVKNGIPFTVYDNVRVEPTDSSFMEAIEF
AQKGAFDAYVAVGGGSTMDTCKAANLYA
Download sequence
Identical sequences E5RFL4
ENSP00000428055 ENSP00000428055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]