SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000428255 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000428255
Domain Number 1 Region: 9-47
Classification Level Classification E-value
Superfamily ARM repeat 0.0000305
Family Regulatory subunit H of the V-type ATPase 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000428255   Gene: ENSG00000047249   Transcript: ENST00000524164
Sequence length 48
Comment pep:known chromosome:GRCh38:8:53715900:53843293:-1 gene:ENSG00000047249 transcript:ENST00000524164 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MTKMDIRGAVDAAVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDLC
Download sequence
Identical sequences A0A2J8L4V2 A0A2J8UN43 E5RJG1
ENSP00000428255 ENSP00000428255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]