SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000428304 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000428304
Domain Number 1 Region: 134-242
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 2.13e-35
Family Phosphonoacetate hydrolase 0.0078
Further Details:      
 
Domain Number 2 Region: 87-128
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000068
Family Somatomedin B domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000428304   Gene: ENSG00000136960   Transcript: ENST00000520066
Sequence length 245
Comment pep:novel chromosome:GRCh38:8:119616253:119638814:-1 gene:ENSG00000136960 transcript:ENST00000520066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARRSSFQSCQIISLFTFAVGVNICLGFTAHRIKRAEGWEEGPPTVLSDSPWTNISGSCK
GRCFELQEAGPPDCRCDNLSRGWECTKDRCGEVRNEENACHCSEDCLARGDCCTNYQVVC
KGESHWVDDDCEEIKAAECPAGFVRPPLIIFSVDGFRASYMKKGSKVMPNIEKLRSCGTH
SPYMRPVYPTKTFPNLYTLATGLYPESHGIVGNSMYDPVFDATFHLRGREKFNHRWWGGQ
PVSFA
Download sequence
Identical sequences E5RJ49
ENSP00000428304 ENSP00000428304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]