SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000428797 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000428797
Domain Number 1 Region: 36-85
Classification Level Classification E-value
Superfamily FnI-like domain 4.6e-21
Family Fibronectin type I module 0.0000811
Further Details:      
 
Domain Number 2 Region: 105-178
Classification Level Classification E-value
Superfamily Kringle-like 5.57e-17
Family Kringle modules 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000428797   Gene: ENSG00000104368   Transcript: ENST00000520523
Sequence length 178
Comment pep:known chromosome:GRCh38:8:42187401:42193727:-1 gene:ENSG00000104368 transcript:ENST00000520523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGARSYQVICRDEKTQMIYQQHQSWLRPV
LRSNRVEYCWCNSGRAQCHSVPVKSCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKCCE
IDTRATCYEDQGISYRGTWSTAESGAECTNWNSSALAQKPYSGRRPDAIRLGLGNHNY
Download sequence
Identical sequences E5RGA1
ENSP00000428797 ENSP00000428797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]