SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000428923 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000428923
Domain Number 1 Region: 10-194
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.88e-72
Family Carbonic anhydrase 0.00000000656
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000428923   Gene: ENSG00000133742   Transcript: ENST00000524324
Sequence length 194
Comment pep:novel chromosome:GRCh38:8:85328565:85378113:-1 gene:ENSG00000133742 transcript:ENST00000524324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPDWGYDDKNVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNS
AKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLL
PSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNN
RPTQPLKGRTVRAS
Download sequence
Identical sequences E5RFE7
ENSP00000428923 ENSP00000428923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]