SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000429284 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000429284
Domain Number 1 Region: 7-47
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000038
Family Canonical RBD 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000429284   Gene: ENSG00000184672   Transcript: ENST00000522647
Sequence length 47
Comment pep:putative chromosome:GRCh38:8:84184941:84529464:1 gene:ENSG00000184672 transcript:ENST00000522647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGKTQTSNVTNKNDPKSINSRVFIGNLNTAIVKKVDIEAIFSKYGK
Download sequence
Identical sequences A0A2J8LPD8 A0A2J8RKL4 E5RIX9
ENSP00000429284 ENSP00000429284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]