SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000429300 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000429300
Domain Number 1 Region: 2-178
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.83e-68
Family Carbonic anhydrase 0.0000000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000429300   Gene: ENSG00000133742   Transcript: ENST00000521679
Sequence length 178
Comment pep:novel chromosome:GRCh38:8:85328489:85338295:-1 gene:ENSG00000133742 transcript:ENST00000521679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAH
WNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPS
TLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQHNNRPTQPLKGRTVRASF
Download sequence
Identical sequences H0YBE2
ENSP00000429300 ENSP00000429300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]