SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000429337 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000429337
Domain Number 1 Region: 13-53
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000824
Family Ankyrin repeat 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000429337   Gene: ENSG00000135299   Transcript: ENST00000522779
Sequence length 54
Comment pep:novel chromosome:GRCh38:6:89562631:89603071:1 gene:ENSG00000135299 transcript:ENST00000522779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQQDAVAALSERLLVAAYKGQTENVVQLINKGARVAVTKGDQTALHRATVVGN
Download sequence
Identical sequences E5RIN9
ENSP00000429337 ENSP00000429337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]