SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000429401 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000429401
Domain Number 1 Region: 209-472
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.56e-87
Family Eukaryotic proteases 0.00000000047
Further Details:      
 
Domain Number 2 Region: 105-212
Classification Level Classification E-value
Superfamily Kringle-like 1.84e-33
Family Kringle modules 0.00000557
Further Details:      
 
Domain Number 3 Region: 36-85
Classification Level Classification E-value
Superfamily FnI-like domain 2.2e-20
Family Fibronectin type I module 0.0000811
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000429401   Gene: ENSG00000104368   Transcript: ENST00000524009
Sequence length 473
Comment pep:novel chromosome:GRCh38:8:42175900:42207565:-1 gene:ENSG00000104368 transcript:ENST00000524009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGARSYQVICRDEKTQMIYQQHQSWLRPV
LRSNRVEYCWCNSGRAQCHSVPVKSCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKCCE
IGNSDCYFGNGSAYRGTHSLTESGASCLPWNSMILIGKVYTAQNPSAQALGLGKHNYCRN
PDGDAKPWCHVLKNRRLTWEYCDVPSCSTCGLRQYSQPQFRIKGGLFADIASHPWQAAIF
AKHRRSPGERFLCGGILISSCWILSAAHCFQERFPPHHLTVILGRTYRVVPGEEEQKFEV
EKYIVHKEFDDDTYDNDIALLQLKSDSSRCAQESSVVRTVCLPPADLQLPDWTECELSGY
GKHEALSPFYSERLKEAHVRLYPSSRCTSQHLLNRTVTDNMLCAGDTRSGGPQANLHDAC
QGDSGGPLVCLNDGRMTLVGIISWGLGCGQKDVPGVYTKVTNYLDWIRDNMRP
Download sequence
Identical sequences A0A2I3TVC0 B4DN26
ENSP00000429401 ENSP00000429401 NP_001306118.1.87134 NP_001306118.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]