SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000429438 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000429438
Domain Number 1 Region: 29-73
Classification Level Classification E-value
Superfamily LysM domain 0.000000000275
Family LysM domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000429438   Gene: ENSG00000164830   Transcript: ENST00000517686
Sequence length 100
Comment pep:putative chromosome:GRCh38:8:106580974:106684340:1 gene:ENSG00000164830 transcript:ENST00000517686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLRNTGQKKTLDKKDGRRMSFQKPKGTIEYTVESRDSLNSIALKFDTTPNELVQLNKLF
SRAVVTGQVLYVPDPEYVSSVESSPSLSPVSPLSPTSSEA
Download sequence
Identical sequences A0A2J8PMX6 A0A2J8X3D6
ENSP00000429438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]