SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000429542 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000429542
Domain Number 1 Region: 3-78
Classification Level Classification E-value
Superfamily Kringle-like 1.76e-19
Family Kringle modules 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000429542   Gene: ENSG00000104368   Transcript: ENST00000521042
Sequence length 96
Comment pep:known chromosome:GRCh38:8:42180306:42187932:-1 gene:ENSG00000104368 transcript:ENST00000521042 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XFAGKCCEIDTRATCYEDQGISYRGTWSTAESGAECTNWNSSALAQKPYSGRRPDAIRLG
LGNHNYCRTPVPRHWAWANIITAGILMGMPSPGATC
Download sequence
Identical sequences H0YBH9
ENSP00000429542 ENSP00000429542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]