SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000429680 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000429680
Domain Number 1 Region: 300-356
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0000000000392
Family VPS37 C-terminal domain-like 0.012
Further Details:      
 
Domain Number 2 Region: 44-105
Classification Level Classification E-value
Superfamily UBC-like 0.000000648
Family UBC-related 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000429680   Gene: ENSG00000155975   Transcript: ENST00000521829
Sequence length 372
Comment pep:known chromosome:GRCh38:8:17247123:17295052:1 gene:ENSG00000155975 transcript:ENST00000521829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSRLLPPQFPQEKPVISVYPP
IRHHLMDKQGVYVTSPLVNNFTMHSDLGKIIQSLLDEFWKNPPVLAPTSTAFPYLYSNPS
GMSPYASQGFPFLPPYPPQEANRSITSLSVADTVSSSTTSHTTAKPAAPSFGVLSNLPLP
IPTVDASIPTSQNGFGYKMPDVPDAFPELSELSVSQLTDMNEQEEVLLEQFLTLPQLKQI
ITDKDDLVKSIEELARKNLLLEPSLEAKRQTVLDKYELLTQMKSTFEKKMQRQHELSESC
SASALQARLKVAAHEAEEESDNIAEDFLEGKMEIDDFLSSFMEKRTICHCRRAKEEKLQQ
AIAMHSQFHAPL
Download sequence
Identical sequences ENSP00000429680 ENSP00000429680 gi|223555921|ref|NP_001138624.1| NP_001138624.1.87134 NP_001138624.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]