SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000429750 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000429750
Domain Number 1 Region: 82-313
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 3.01e-56
Family Neurotransmitter-gated ion-channel transmembrane pore 0.0025
Further Details:      
 
Domain Number 2 Region: 2-81
Classification Level Classification E-value
Superfamily Nicotinic receptor ligand binding domain-like 5.75e-17
Family Nicotinic receptor ligand binding domain-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000429750   Gene: ENSG00000145864   Transcript: ENST00000517547
Sequence length 314
Comment pep:putative chromosome:GRCh38:5:161293898:161546697:-1 gene:ENSG00000145864 transcript:ENST00000517547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLITK
KVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGIT
TVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYALVNYIFFGRGPQRQKK
AAEKAASANNEKMRLDVNKMDPHENILLSTLEIKNEMATSEAVMGLGDPRSTMLAYDASS
IQYRKAGLPRHSFGRNALERHVAQKKSRLRRRASQLKITIPDLTDVNAIDRWSRIFFPVV
FSFFNIVYWLYYVN
Download sequence
Identical sequences A0A2J8NKH8 A0A2J8X6X1 B7Z279 F7HJL3
ENSCJAP00000027968 ENSP00000429750 ENSP00000429750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]