SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000429827 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000429827
Domain Number 1 Region: 9-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-26
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000429827   Gene: ENSG00000178338   Transcript: ENST00000520377
Sequence length 134
Comment pep:known chromosome:GRCh38:5:178860687:178882854:1 gene:ENSG00000178338 transcript:ENST00000520377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGQREARPQVSLTFEDVAVLFTWDEWRKLAPSQRNLYRDVMLENYRNLVSLGLSFTKP
KVISLLQQGEDPWEVEKDSSGVSSLGCKSTPKMTKSTQTQDSFQEQIRKRLKRDEPWNFI
SERSCIYEEKLKKQ
Download sequence
Identical sequences E5RH89
ENSP00000429827 ENSP00000429827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]