SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000429858 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000429858
Domain Number 1 Region: 98-154
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.00000000000916
Family VPS37 C-terminal domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000429858   Gene: ENSG00000155975   Transcript: ENST00000521976
Sequence length 170
Comment pep:putative chromosome:GRCh38:8:17276436:17286611:1 gene:ENSG00000155975 transcript:ENST00000521976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PDAFPELSELSVSQLTDMNEQEEVLLEQFLTLPQLKQIITDKDDLVKSIEELARKNLLLE
PSLEAKRQTVLDKYELLTQMKSTFEKKMQRQHELSESCSASALQARLKVAAHEAEEESDN
IAEDFLEGKMEIDDFLSSFMEKRTICHCRRAKEEKLQQAIAMHSQFHAPL
Download sequence
Identical sequences A0A2J8X400 H0YBN0
ENSP00000429858 ENSP00000429858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]