SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000430128 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000430128
Domain Number 1 Region: 13-114
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.71e-20
Family Canonical RBD 0.0000144
Further Details:      
 
Weak hits

Sequence:  ENSP00000430128
Domain Number - Region: 210-258
Classification Level Classification E-value
Superfamily Tropomyosin 0.0432
Family Tropomyosin 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000430128   Gene: ENSG00000184672   Transcript: ENST00000517638
Sequence length 304
Comment pep:putative chromosome:GRCh38:8:84184875:84921844:1 gene:ENSG00000184672 transcript:ENST00000517638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKRRRLKQGEPIMTGKTQTSNVTNKNDPKSINSRVFIGNLNTAIVKKVDIEAIFSKYGK
IVGCSVHKGYAFVQYMSERHARAAVAGENARVIAGQPLDINMAGEPKPYRPKPGNKRPLS
ALYRLESKEPFLSVGGYVFDYDYYRDDFYNRLFDYHGRVPPPPRAVIPLKRPRVAVTTTR
RGKGVFSMKGGSRSTASGSTGSKLKSDELQTIKKELTQIKTKIDSLLGRLEKIEKQQKAE
AEAQKKQLEESLVLIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFDEDGGHELF
LQIK
Download sequence
Identical sequences A0A2I2Z435 A0A2I3MLH1 A0A2I3SDH2 A0A2J8RKR4 A0A2K5NN80 A0A2K5ZKA0 A0A2K6C597
NP_001093861.1.87134 NP_001093861.1.92137 XP_007999175.1.81039 XP_011731810.1.29376 XP_011851040.1.47321 XP_016815102.1.37143 XP_018888409.1.27298 gi|154240692|ref|NP_001093861.1| ENSP00000430065 ENSP00000430128 ENSP00000430128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]