SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000430190 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000430190
Domain Number 1 Region: 124-321
Classification Level Classification E-value
Superfamily Ribonuclease H-like 5.39e-41
Family DnaQ-like 3'-5' exonuclease 0.00000000286
Further Details:      
 
Domain Number 2 Region: 76-112
Classification Level Classification E-value
Superfamily SAP domain 0.0000961
Family SAP domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000430190   Gene: ENSG00000104626   Transcript: ENST00000519292
Sequence length 349
Comment pep:known chromosome:GRCh38:8:9002844:9033338:1 gene:ENSG00000104626 transcript:ENST00000519292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDPQSKEPAGEAVALALLESPRPEGGEEPPRPSPEETQQCKFDGQETKGSKFITSSASD
FSDPVYKEIAITNGCINRMSKEELRAKLSEFKLETRGVKDVLKKRLKNYYKKQKLMLKES
NFADSYYDYICIIDFEATCEEGNPPEFVHEIIEFPVVLLNTHTLEIEDTFQQYVRPEINT
QLSDFCISLTGITQDQVDRADTFPQVLKKVIDWMKLKELGTKYKYSLLTDGSWDMSKFLN
IQCQLSRLKYPPFAKKWINIRKSYGNFYKVPRSQTKLTIMLEKLGMDYDGRPHCGLDDSK
NIARIAVRMLQDGCELRINEKMHAGQLMSVSSSLPIEGTPPPQMPHFRK
Download sequence
Identical sequences A0A024R355 Q8IV48
gi|31543184|ref|NP_699163.2| NP_699163.2.87134 NP_699163.2.92137 ENSP00000250263 ENSP00000250263 ENSP00000429615 ENSP00000430190 ENSP00000250263 ENSP00000429615 ENSP00000430190 GO.37046 9606.ENSP00000250263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]