SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000430543 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000430543
Domain Number 1 Region: 6-138
Classification Level Classification E-value
Superfamily Carbonic anhydrase 3.93e-47
Family Carbonic anhydrase 0.000000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000430543   Gene: ENSG00000133742   Transcript: ENST00000519991
Sequence length 138
Comment pep:putative chromosome:GRCh38:8:85328594:85378113:-1 gene:ENSG00000133742 transcript:ENST00000519991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMTKMLHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGK
RAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSN
VEGDNAVPMQHNNRPTQP
Download sequence
Identical sequences ENSP00000430543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]