SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000430571 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000430571
Domain Number 1 Region: 6-87
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.22e-25
Family Carbonic anhydrase 0.00000572
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000430571   Gene: ENSG00000133742   Transcript: ENST00000520663
Sequence length 87
Comment pep:putative chromosome:GRCh38:8:85329756:85378113:-1 gene:ENSG00000133742 transcript:ENST00000520663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMTKMLHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGK
RAPFTNFDPSTLLPSSLDFWTYPGSLT
Download sequence
Identical sequences E5RJF6
ENSP00000430571 ENSP00000430571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]