SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000430912 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000430912
Domain Number 1 Region: 5-246
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.58e-28
Family WD40-repeat 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000430912   Gene: ENSG00000105339   Transcript: ENST00000523308
Sequence length 248
Comment pep:putative chromosome:GRCh38:8:141188349:141195802:1 gene:ENSG00000105339 transcript:ENST00000523308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMADQNQVWVGSEDSVIYIINVHSMSCNKQLTAHCSSVTDLIVQDGQEAPSNVYSCSMD
GMVLVWNVSTLQVTSRFQLPRGGLTSIRLHGGRLWCCTGNSIMVMKMNGSLHQELKIEEN
FKDTSTSFLAFQLLPEEEQLWAACAGRSEVYIWSLKDLAQPPQRVPLEDCSEINCMIRVK
KQVWVGSRGLGQGTPKGKIYVIDAERKTVEKELVAHMDTVRTLCSAEDRYVLSGSGREEG
KVAIWKGE
Download sequence
Identical sequences B3KRG7
ENSP00000430912 ENSP00000430912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]