SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000431020 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000431020
Domain Number 1 Region: 3-71
Classification Level Classification E-value
Superfamily GAS2 domain-like 7.06e-23
Family GAS2 domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000431020   Gene: ENSG00000151914   Transcript: ENST00000523292
Sequence length 259
Comment pep:novel chromosome:GRCh38:6:56458060:56469956:-1 gene:ENSG00000151914 transcript:ENST00000523292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XTRQVAKCKCAKRFQVEQIGDNKYRFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKN
DPCRAKGRTNMELREKFILADGASQGMAAFRPRGRRSRPSSRGASPNRSTSVSSQAAQAA
SPQVPATTTPKGTPIQGSKLRLPGYLSGKGFHSGEDSGLITTAAARVRTQFADSKKTPSR
PGSRAGSKAGSRASSRRGSDASDFDISEIQSVCSDVETVPQTHRPTPRAGSRPSTAKPSK
IPTPQRKSPASKLDKSSKR
Download sequence
Identical sequences H0YC65
ENSP00000431020 ENSP00000431020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]